PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042360t1
Common NameTCM_042360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 246aa    MW: 27235.4 Da    PI: 6.2776
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042360t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.92.2e-0889131850
                       HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                       rr   NReA r++R++Kka ++ Lee+vk+L   N++L  +l+
  Thecc1EG042360t1  89 RRPSGNREAVRKYREKKKAHTAYLEEEVKKLRLLNQQLVRKLQ 131
                       56667*********************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.4E-1183150No hitNo description
SMARTSM003381.1E-683149IPR004827Basic-leucine zipper domain
PfamPF077164.7E-1387131IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.38E-788132No hitNo description
CDDcd146862.50E-1089140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MDDGEVELSD HVLLSNPDSS SNLLDSTSVD LIIDEFFKNT RTCTHTHTCN PPGPDTAHTH  60
TCYHTHTQVI TSEEDDHQNN KNSSSLKPRR PSGNREAVRK YREKKKAHTA YLEEEVKKLR  120
LLNQQLVRKL QGQTILEAEV LRLRSLLVDL RAKIDGGLGV FPFQKQCNNA TILKEGDCGV  180
QSTDESIGLQ CQTDLPCFHP HAGSSSQASI GGSEKMNISW EGNCQPAIVN CQANINQMEV  240
LKDTT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007008741.10.0Basic-leucine zipper transcription factor family protein isoform 1
RefseqXP_007008742.10.0Basic-leucine zipper transcription factor family protein isoform 1
SwissprotQ8GTS23e-55BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A061FLJ10.0A0A061FLJ1_THECC; Basic-leucine zipper transcription factor family protein isoform 1
STRINGVIT_13s0158g00380.t014e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51960.26e-25basic leucine zipper 24
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]